Placenta-specific Protein 1, Recombinant, Human, aa23-212, His-Tag

Product Overview

• Article Name: Placenta-specific Protein 1, Recombinant, Human, aa23-212, His-Tag
• Biozol Catalog Number: USB-585788
• Supplier Catalog Number: 585788
• Alternative Catalog Number: USB-585788-20, USB-585788-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

May play a role in placental development. Source: Recombinant protein corresponding to aa23-212 from human Placenta-specific protein 1, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~23.3kD Amino Acid Sequence: QSPMTVLCSIDWFMVTVHPFMLNNDVCVHFHELHLGLGCPPNHVQPHAYQFTYRVTECGIRAKAVSQDMVIYSTEIHYSSKGTPSKFVIPVSCAAPQKSPWLTKPCSMRVASKSRATAQKDEKCYEVFSLSQSSQRPNCDCPPCVFSEEEHTQVPCHQAGAQEAQPLQPSHFLDISEDWSLHTDDMIGSM Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 23.3
• UniProt: Q9HBJ0
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.