Plasmodesmata-located Protein 7, Recombinant, Arabidopsis Thaliana, aa31-298, His-SUMO-Tag

Product Overview

• Article Name: Plasmodesmata-located Protein 7, Recombinant, Arabidopsis Thaliana, aa31-298, His-SUMO-Tag
• Biozol Catalog Number: USB-585804
• Supplier Catalog Number: 585804
• Alternative Catalog Number: USB-585804-20, USB-585804-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Modulates cell-to-cell trafficking. Source: Recombinant protein corresponding to aa31-298 from Arabidopsis thaliana Plasmodesmata-located protein 7, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~41.3kD Amino Acid Sequence: TSATDTFVFGGCSQQKFSPASAYESNLNSLLTSLVNSATYSSYNNFTIMGSSSSDTARGLFQCRGDLSMPDCATCVARAVSQVGPLCPFTCGGALQLAGCYIKYDNISFLGQEDKTVVLKKCGSSEGYNTDGISRRDAVLTELVNGGGYFRAGGSGDVQGMGQCVGDLTVSECQDCLGTAIGRLKNDCGTAVFGDMFLAKCYARYSTDGAQHYAKSHNYKTNYGGEKTFAIIIGLLAAVVLLIIFLLFLRGVCSRGGDFSILHSFTLI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 41.3
• UniProt: Q0WPN8
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.