Platelet Glycoprotein Ib Alpha Chain, Recombinant, Human, aa553-652, His-Tag, Myc-Tag

Catalog Number: USB-585807
Article Name: Platelet Glycoprotein Ib Alpha Chain, Recombinant, Human, aa553-652, His-Tag, Myc-Tag
Biozol Catalog Number: USB-585807
Supplier Catalog Number: 585807
Alternative Catalog Number: USB-585807-20, USB-585807-100
Manufacturer: US Biological
Category: Molekularbiologie
GP-Ib, a surface membrane protein of platelets, participates in the formation of platelet plugs by binding to the A1 domain of vWF, which is already bound to the subendothelium. Source: Recombinant protein corresponding to aa553-652 from human Platelet glycoprotein Ib alpha chain, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~15.9kD Amino Acid Sequence: SWVGHVKPQALDSGQGAALTTATQTTHLELQRGRQVTVPRAWLLFLRGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYSGHSL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 15.9
UniProt: P07359
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.