Pollen Allergen Dac g 3, Recombinant, Dactylis glomerata, aa1-96, His-SUMO-Tag

Catalog Number: USB-585820
Article Name: Pollen Allergen Dac g 3, Recombinant, Dactylis glomerata, aa1-96, His-SUMO-Tag
Biozol Catalog Number: USB-585820
Supplier Catalog Number: 585820
Alternative Catalog Number: USB-585820-20,USB-585820-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa1-96 from Dactylis glomerata Pollen allergen Dac g 3, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~26.9kD Amino Acid Sequence: VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKKGNLWEVKSSKPLTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPEE Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 26.9
UniProt: P93124
Purity: 90% (SDS-PAGE)
Form: Supplied as a liquid in Tris, 50% glycerol