Pollen Allergen Phl p 5a, Recombinant, Phleum pratense, aa1-286, His-SUMO-Tag

Catalog Number: USB-585825
Article Name: Pollen Allergen Phl p 5a, Recombinant, Phleum pratense, aa1-286, His-SUMO-Tag
Biozol Catalog Number: USB-585825
Supplier Catalog Number: 585825
Alternative Catalog Number: USB-585825-20, USB-585825-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa1-286 from Phleum pratense Pollen allergen Phl p 5a, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~44.5kD Amino Acid Sequence: ADLGYGPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGAGVQPADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 44.5
UniProt: Q40962
Purity: 90% (SDS-PAGE)
Form: Supplied as a liquid in Tris, 50% glycerol