Polyphosphate Kinase 2, Recombinant, Chlorobium tepidum, aa140-343, His-Tag, Myc-Tag

Catalog Number: USB-585840
Article Name: Polyphosphate Kinase 2, Recombinant, Chlorobium tepidum, aa140-343, His-Tag, Myc-Tag
Biozol Catalog Number: USB-585840
Supplier Catalog Number: 585840
Alternative Catalog Number: USB-585840-20,USB-585840-100
Manufacturer: US Biological
Category: Molekularbiologie
Catalyzes the reversible transfer of the terminal phosphate of ATP to form a long-chain polyphosphate (polyP). Source: Recombinant protein corresponding to aa140-343 from Chlorobium tepidum Polyphosphate kinase 2, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~34.4kD Amino Acid Sequence: EQQQLLQHYFRKEVFPVLTPLAFDTGHPFPFMSNLSLNLAIELEDEESGAIKFARVKVPGILSRIIRLDQIEGLGFDDGRIRLLWLEDLVEHNLDQLFPKMRILQCHPFRIIRDADIEIEEDEAGDLLESIEQGVRSRRYGKVVRLDINPDMPHSIRSLLVKNLETYERNVYEIGGVLGMSALMELLKIDRPDLKDELFVPNNP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 34.4
UniProt: O68984
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.