Pre-glycoprotein Polyprotein GP Complex, Recombinant, Lymphocytic Choriomeningitis Virus, aa10-90, His-SUMO-Tag
Biozol Catalog Number:
USB-585859
Supplier Catalog Number:
585859
Alternative Catalog Number:
USB-585859-20, USB-585859-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Stable signal peptide is cleaved but is apparently retained as the third component of the GP complex. The SSP is required for efficient glycoprotein expression, post-translational cleavage of GP1 and GP2, glycoprotein transport to the cell plasma membrane, formation of infectious virus particles, and acid pH-dependent glycoprotein-mediated cell fusion. Source: Recombinant protein corresponding to aa10-90 from Lymphocytic choriomeningitis virus Pre-glycoprotein polyprotein GP complex, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~24.9kD Amino Acid Sequence: ALPHIIDEVINIVIIVLIVITGIKAVYNFATCGIFALISFLLLAGRSCGMYGLKGPDIYKGVYQFKSVEFDMSHLNLTMPN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted