Pregnancy-associated Glycoprotein 2, Recombinant, Bovine, aa22-376, His-Tag

Catalog Number: USB-585865
Article Name: Pregnancy-associated Glycoprotein 2, Recombinant, Bovine, aa22-376, His-Tag
Biozol Catalog Number: USB-585865
Supplier Catalog Number: 585865
Alternative Catalog Number: USB-585865-20, USB-585865-100
Manufacturer: US Biological
Category: Molekularbiologie
PAG2 or a processed derivative of this molecule might represent a factor that binds the LH receptor. Source: Recombinant protein corresponding to aa22-376 from bovine Pregnancy-associated glycoprotein 2, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~43.6kD Amino Acid Sequence: KKMKTLRETLREKNLLNNFLEEQAYRLSKNDSKITIHPLRNYLDTAYVGNITIGTPPQEFRVVFDTGSANLWVPCITCTSPACYTHKTFNPQNSSSFREVGSPITIFYGSGIIQGFLGSDTVRIGNLVSPEQSFGLSLEEYGFDSLPFDGILGLAFPAMGIEDTIPIFDNLWSHGAFSEPVFAFYLNTNKPEGSVVMFGGVDHRYYKGELNWIPVSQTSHWQISMNNISMNGTVTACSCGCEALLDTGTSMIYGPTKLVTNIHKLMNARLENSEYVVSCDAVKTLPPVIFNINGIDYPLRPQAYIIKIQNSCRSVFQGGTENSSLNTWILGDIFLRQYFSVFDRKNRRIGLAPAV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 43.6
UniProt: Q28057
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.