Pro-neuropeptide Y, Recombinant, Mouse, aa29-64, hFc-Tag

Catalog Number: USB-585873
Article Name: Pro-neuropeptide Y, Recombinant, Mouse, aa29-64, hFc-Tag
Biozol Catalog Number: USB-585873
Supplier Catalog Number: 585873
Alternative Catalog Number: USB-585873-20,USB-585873-100
Manufacturer: US Biological
Category: Molekularbiologie
NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone. Recombinant protein corresponding to aa29-64 from mouse Pro-neuropeptide Y, fused to hFc-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~30.9kD Amino Acid Sequence: YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 30.9
UniProt: P57774
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.