Pro-resilin, Recombinant, Drosophila melanogaster, aa342-620, His-Tag, Myc-Tag

Catalog Number: USB-585874
Article Name: Pro-resilin, Recombinant, Drosophila melanogaster, aa342-620, His-Tag, Myc-Tag
Biozol Catalog Number: USB-585874
Supplier Catalog Number: 585874
Alternative Catalog Number: USB-585874-20,USB-585874-100
Manufacturer: US Biological
Category: Molekularbiologie
Plays a central role in insect flight by providing low stiffness, high strain and efficient energy storage. Source: Recombinant protein corresponding to aa342-620 from Drosophila melanogaster Pro-resilin, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~34.9kD Amino Acid Sequence: PAKYEFNYQVEDAPSGLSFGHSEMRDGDFTTGQYNVLLPDGRKQIVEYEADQQGYRPQIRYEGDANDGSGPSGPGGPGGQNLGADGYSSGRPGNGNGNGNGGYSGGRPGGQDLGPSGYSGGRPGGQDLGAGGYSNGKPGGQDLGPGGYSGGRPGGQDLGRDGYSGGRPGGQDLGASGYSNGRPGGNGNGGSDGGRVIIGGRVIGGQDGGDQGYSGGRPGGQDLGRDGYSSGRPGGRPGGNGQDSQDGQGYSSGRPGQGGRNGFGPGGQNGDNDGSGYRY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 34.9
UniProt: Q9V7U0
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.