Probable Endo-beta-1,4-glucanase D, Recombinant, Aspergillus kawachii, aa21-408, His-Tag

Catalog Number: USB-585879
Article Name: Probable Endo-beta-1,4-glucanase D, Recombinant, Aspergillus kawachii, aa21-408, His-Tag
Biozol Catalog Number: USB-585879
Supplier Catalog Number: 585879
Alternative Catalog Number: USB-585879-20
Manufacturer: US Biological
Category: Molekularbiologie
Has endoglucanase activity on substrates containing beta-1,4 glycosidic bonds, like in carboxymethylcellulose (CMC), hydroxyethylcellulose (HEC) and beta-glucan. Involved in the degradation of complex natural cellulosic substrates. Source: Recombinant protein corresponding to aa21-408 from Aspergillus kawachii Probable endo-beta-1,4-glucanase D, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~41.7kD Amino Acid Sequence: HTTVQAVWINGEDQGLGNTDDGYIRSPPSNSPVTDVTSTDMTCNVNGDQAASKTLSVKAGDVVTFEWHHSDRSDSDDIIASSHKGPVQVYMAPTAKGSNGNNWVKIAEDGYHKSSDEWATDILIANKGKHNITVPDVPAGNYLFRPEIIALHEGNREGGAQFYMECVQFKVTSDGSNELPSGVSIPGVYTATDPGILFDIYNSFDSYPIPGPDVWDGSSSGSSSSGSSSAAVSSAAAAATTSAVAATTPATQAAVEVSSSAAAATTEAAAPVVSSAAPVQQATSAVTSQAQAAPTTFATSSKKSSKTACKNKTKSNSQVAAATSSVVAPAATSSVVPVVSASASASAGGVAKQYERCGGINHTGPTTCESGSVCKKWNPYYYQCVASQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 41.7
UniProt: Q96WQ9
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.