Probable Non-specific Lipid-transfer Protein 2, Recombinant, Parietaria judaica, aa32-133, His-Tag
Biozol Catalog Number:
USB-585888
Supplier Catalog Number:
585888
Alternative Catalog Number:
USB-585888-20,USB-585888-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues. Source: Recombinant protein corresponding to aa32-133 from parietaria judaica Probable non-specific lipid-transfer protein 2, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~13.3kD Amino Acid Sequence: EEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADFDCSKIQSTIFRGYY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted