Probable Transcriptional Regulatory Protein MAP_1030, Recombinant, Mycobacterium paratuberculosis, aa1-250, His-Tag

Catalog Number: USB-585891
Article Name: Probable Transcriptional Regulatory Protein MAP_1030, Recombinant, Mycobacterium paratuberculosis, aa1-250, His-Tag
Biozol Catalog Number: USB-585891
Supplier Catalog Number: 585891
Alternative Catalog Number: USB-585891-20, USB-585891-200
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa1-250 from Mycobacterium paratuberculosis Probable transcriptional regulatory protein MAP_1030, fused to 10X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~32.8kD Amino Acid Sequence: MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPAGNPTLYDAIQKAKKSSVPNENIERARKRGAGEEAGGADWQTITYEGYAPNGVAVLIECLTDNRNRAASEVRVAMTRNGGTMADPGSVSYLFSRKSVVTCEKNGLTEDDILAAVLDAGAEEVEDLGDSFEIICEPTDLVAVRTALQDAGIDYDSAEAGFQPSVTVPLNADGAQKVMRLVDALEDSDDVQDVWTNADIPDEILAQIEE Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 32.8
UniProt: P62039
Purity: 85% (SDS-PAGE)
Form: Supplied as a liquid in Tris, 50% glycerol