Probable Transcriptional Regulatory Protein MAP_1030, Recombinant, Mycobacterium paratuberculosis, aa1-250, His-Tag

Catalog Number: USB-585892
Article Name: Probable Transcriptional Regulatory Protein MAP_1030, Recombinant, Mycobacterium paratuberculosis, aa1-250, His-Tag
Biozol Catalog Number: USB-585892
Supplier Catalog Number: 585892
Alternative Catalog Number: USB-585892-20,USB-585892-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa1-250 from mycobacterium paratuberculosis Probable transcriptional regulatory protein MAP_1030, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~28.8kD Amino Acid Sequence: MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPAGNPTLYDAIQKAKKSSVPNENIERARKRGAGEEAGGADWQTITYEGYAPNGVAVLIECLTDNRNRAASEVRVAMTRNGGTMADPGSVSYLFSRKSVVTCEKNGLTEDDILAAVLDAGAEEVEDLGDSFEIICEPTDLVAVRTALQDAGIDYDSAEAGFQPSVTVPLNADGAQKVMRLVDALEDSDDVQDVWTNADIPDEILAQIEE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 28.8
UniProt: P62039
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.