Proepiregulin, Recombinant, Human, aa60-119, His-SUMO-Tag

Catalog Number: USB-585897
Article Name: Proepiregulin, Recombinant, Human, aa60-119, His-SUMO-Tag
Biozol Catalog Number: USB-585897
Supplier Catalog Number: 585897
Alternative Catalog Number: USB-585897-20,USB-585897-100
Manufacturer: US Biological
Category: Molekularbiologie
Ligand of the EGF receptor/EGFR and ERBB4. Stimulates EGFR and ERBB4 tyrosine phosphorylation. Source: Recombinant protein corresponding to aa60-119 from human Proepiregulin2, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~22.9kD Amino Acid Sequence: VAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKEYV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 22.9
UniProt: O14944
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.