Progonadoliberin-1, Recombinant, Rat, aa24-92, His-Tag

Catalog Number: USB-585901
Article Name: Progonadoliberin-1, Recombinant, Rat, aa24-92, His-Tag
Biozol Catalog Number: USB-585901
Supplier Catalog Number: 585901
Alternative Catalog Number: USB-585901-20,USB-585901-100
Manufacturer: US Biological
Category: Molekularbiologie
Stimulates the secretion of gonadotropins, it stimulates the secretion of both luteinizing and follicle-stimulating hormones. Source: Recombinant protein corresponding to aa24-92 from rat Progonadoliberin-1, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~12.2kD Amino Acid Sequence: QHWSYGLRPGGKRNTEHLVDSFQEMGKEEDQMAEPQNFECTVHWPRSPLRDLRGALERLIEEEAGQKKM Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 12.2
UniProt: P07490
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.