Programmed Cell Death 1 Ligand 2, Recombinant, Human, aa21-118, His-Tag

Catalog Number: USB-585903
Article Name: Programmed Cell Death 1 Ligand 2, Recombinant, Human, aa21-118, His-Tag
Biozol Catalog Number: USB-585903
Supplier Catalog Number: 585903
Alternative Catalog Number: USB-585903-20,USB-585903-100,USB-585903-1
Manufacturer: US Biological
Category: Molekularbiologie
Involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production (By similarity). Source: Recombinant protein corresponding to aa21-118 from human Programmed cell death 1 ligand 2, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~15.1kD Amino Acid Sequence: FTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 15.1
UniProt: Q9BQ51
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.