Prolactin-3D1, Recombinant, Mouse, aa30-224, His-Tag

Catalog Number: USB-585912
Article Name: Prolactin-3D1, Recombinant, Mouse, aa30-224, His-Tag
Biozol Catalog Number: USB-585912
Supplier Catalog Number: 585912
Alternative Catalog Number: USB-585912-20,USB-585912-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa30-224 from mouse Prolactin-3D1, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~26.4kD Amino Acid Sequence: SKPTAMVPTEDLYTRLAELLHNTFILAADVYREFDLDFFDKTWITDRTLPLCHTASIHTPENREEVHETKTEDLLKAMINVSISWKEPLKHLVSALTALPGASESMGKKAADIKGRNLVILEGLQTIYNRSQANIEENENFDYPAWSGLEELQSPNEDTHLFAVYNLCRCIKRDIHKIDSYIKVLRCRVVFQNEC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 26.4
UniProt: P18121
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.