Prostaglandin E Synthase 3, Recombinant, Human, aa1-160, His-Tag

Product Overview

• Article Name: Prostaglandin E Synthase 3, Recombinant, Human, aa1-160, His-Tag
• Biozol Catalog Number: USB-585927
• Supplier Catalog Number: 585927
• Alternative Catalog Number: USB-585927-20,USB-585927-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Cytosolic prostaglandin synthase that catalyzes the oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2). Molecular chaperone that localizes to genomic response elements in a hormone-dependent manner and disrupts receptor-mediated transcriptional activation, by promoting disassembly of transcriptional regulatory complexes. Facilitates HIF alpha proteins hydroxylation via interaction with EGLN1/PHD2, leading to recruit EGLN1/PHD2 to the HSP90 pathway. Source: Recombinant protein corresponding to aa1-160 from human Prostaglandin E synthase 3, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~20.7kD Amino Acid Sequence: MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 20.7
• UniProt: Q15185
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.