Prostate Stem Cell Antigen, Recombinant, Human, aa13-86, His-Tag

Catalog Number: USB-585928
Article Name: Prostate Stem Cell Antigen, Recombinant, Human, aa13-86, His-Tag
Biozol Catalog Number: USB-585928
Supplier Catalog Number: 585928
Alternative Catalog Number: USB-585928-20, USB-585928-100
Manufacturer: US Biological
Category: Molekularbiologie
May be involved in the regulation of cell proliferation. Has a cell-proliferation inhibition activity in vitro. Recombinant protein corresponding to aa13-86 from human Prostate stem cell antigen, fused to 6X His-Tag at N-terminal and 6X His-Tag at C-terminal, expressed in E. coli. Swiss/Uniprot Number: O43653 Molecular Weight: ~13.4kD Amino Acid Sequence: LCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 13.4
UniProt: O43653
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.