Protein A33, Recombinant, Vaccinia virus, aa57-185, His-Tag
Biozol Catalog Number:
USB-585930
Supplier Catalog Number:
585930
Alternative Catalog Number:
USB-585930-20, USB-585930-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Coordinates the incorporation of A36 into intracellular enveloped virion (IEV) membranes and, subsequently, the production of actin tails. Therefore plays an essential role in efficient cell-to-cell spread of viral particles (By similarity). Source: Recombinant protein corresponding to aa57-185 from Vaccinia virus Protein A33, fused to 10X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~17.8kD Amino Acid Sequence: VRLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted