Protein B5, Recombinant, Vaccinia virus, aa18-279, His-Tag

Product Overview

• Article Name: Protein B5, Recombinant, Vaccinia virus, aa18-279, His-Tag
• Biozol Catalog Number: USB-585941
• Supplier Catalog Number: 585941
• Alternative Catalog Number: USB-585941-20, USB-585941-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Plays a role in the dissolution of the outermost membrane of extracellular enveloped virions (EEV) to allow virion entry into host cells. Participates also in wrapping intracellular mature virions (IMV) to form intracellular enveloped virions (IEV). Source: Recombinant protein corresponding to aa18-279 from Vaccinia virus Protein B5, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~31.1kD Amino Acid Sequence: YSTCTVPTMNNAKLTSTETSFNNNQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYISELYNKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGASYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFILTGSPSSTCIDGKWNPVLPICVRTNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 31.1
• UniProt: P21115
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.