Protein DEK, Recombinant, Human, aa309-375, His-Tag, Myc-Tag

Catalog Number: USB-585953
Article Name: Protein DEK, Recombinant, Human, aa309-375, His-Tag, Myc-Tag
Biozol Catalog Number: USB-585953
Supplier Catalog Number: 585953
Alternative Catalog Number: USB-585953-20, USB-585953-100
Manufacturer: US Biological
Category: Molekularbiologie
Involved in chromatin organization. Source: Recombinant protein corresponding to aa309-375 from human Protein DEK, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~15.7kD Amino Acid Sequence: DEPLIKKLKKPPTDEELKETIKKLLASANLEEVTMKQICKKVYENYPTYDLTERKDFIKTTVKELISLEH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 15.7
UniProt: P35659
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.