Protein E7, Recombinant, Human papillomavirus type 16, aa1-98, GST-Tag
Biozol Catalog Number:
USB-585964
Supplier Catalog Number:
585964
Alternative Catalog Number:
USB-585964-20,USB-585964-100,USB-585964-1
Manufacturer:
US Biological
Category:
Molekularbiologie
Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. E7 protein has both transforming and trans-activating activities. Induces the disassembly of the E2F1 transcription factor from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Interferes with host histone deacetylation mediated by HDAC1 and HDAC2, leading to transcription activation. Plays also a role in the inhibition of both antiviral and antiproliferative functions of host interferon alpha. Interaction with host TMEM173/STING impairs the ability of TMEM173/STING to sense cytosolic DNA and promote the production of type I interferon (IFN-alpha and IFN-beta). Full length recombinant protein corresponding to aa1-98 from Human papillomavirus type 16 Protein E7, fused to GST-Tag at N-terminal, expressed in E.coli. Siwiss/Uniprot: P03129 Molecular Weight: ~38.0kD Amino Acid Sequence: MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.