Protein FAM3B, Recombinant, Mouse, aa30-235, hFc-Tag

Product Overview

• Article Name: Protein FAM3B, Recombinant, Mouse, aa30-235, hFc-Tag
• Biozol Catalog Number: USB-585969
• Supplier Catalog Number: 585969
• Alternative Catalog Number: USB-585969-20,USB-585969-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Induces apoptosis of alpha and beta cells in a dose- and time-dependent manner. Source: Recombinant protein corresponding to aa30-235 from mouse Protein FAM3B, fused to hFC-Tag at C-terminal, expressed in Mammalian cell. Molecular Weight: ~51.9kD Amino Acid Sequence: ELIPDVPLSSTLYNIRSIGERPVLKAPAPKRQKCDHWSPCPPDTYAYRLLSGGGRDKYAKICFEDEVLIGEKTGNVARGINIAVVNYETGKVIATKYFDMYEGDNSGPMAKFIQSTPSKSLLFMVTHDDGSSKLKAQAKDAIEALGSKEIKNMKFRSSWVFVAAKGFELPSEIEREKINHSDQSRNRYAGWPAEIQIEGCIPKGLR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 51.9
• UniProt: Q9D309
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.