Protein FAM72A, Recombinant, Human, aa1-149, His-Tag

Catalog Number: USB-585972
Article Name: Protein FAM72A, Recombinant, Human, aa1-149, His-Tag
Biozol Catalog Number: USB-585972
Supplier Catalog Number: 585972
Alternative Catalog Number: USB-585972-20, USB-585972-100
Manufacturer: US Biological
Category: Molekularbiologie
May play a role in the regulation of cellular reactive oxygen species metabolism. May participate in cell growth regulation. Source: Recombinant protein corresponding to aa1-149 from human Protein FAM72A, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~20.7kD Amino Acid Sequence: MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCYFTKICKCKLKDIACLKCGNIVGYHVIVPCSSCLLSCNNGHFWMFHSQAVYDINRLDSTGVNVLLWGNLPEIEESTDEDVLNISAEECIR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 20.7
UniProt: Q5TYM5
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.