Protein jagged-1, Recombinant, Human, aa185-334

Catalog Number: USB-585977
Article Name: Protein jagged-1, Recombinant, Human, aa185-334
Biozol Catalog Number: USB-585977
Supplier Catalog Number: 585977
Alternative Catalog Number: USB-585977-20, USB-585977-100
Manufacturer: US Biological
Category: Molekularbiologie
Ligand for multiple Notch receptors and involved in the mediation of Notch signaling. May be involved in cell-fate decisions during hematopoiesis. Seems to be involved in early and late stages of mammalian cardiovascular development. Inhibits myoblast differentiation. Enhances fibroblast growth factor-induced angiogenesis (in vitro). Source: Recombinant protein corresponding to aa185-334 from human Protein jagged-1, fused to FC-Myc-Tag at C-terminal, expressed in Mammalian cell. Molecular Weight: ~46.8kD Amino Acid Sequence: VTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 46.8
UniProt: P78504
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.