Protein K3, Recombinant, Vaccinia Virus, aa1-88, His-Tag

Product Overview

• Article Name: Protein K3, Recombinant, Vaccinia Virus, aa1-88, His-Tag
• Biozol Catalog Number: USB-585979
• Supplier Catalog Number: 585979
• Alternative Catalog Number: USB-585979-20
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Viral mimic of eIF-2-alpha that acts as a pseudosubstrate for EIF2AK2/PKR kinase. Inhibits therefore eIF-2-alpha phosphorylation by host EIF2AK2/PKR kinase and prevents protein synthesis shutoff. Source: Recombinant protein corresponding to aa1-88 from Vaccinia virus Protein K3, fused to 6X His-Tag at N-terminal, expressed in Baculovirus. Molecular Weight: ~11.6kD Amino Acid Sequence: MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 11.6
• UniProt: P18378
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.