Protein Mono-ADP-ribosyltransferase PARP14, Recombinant, Human, aa1605-1801, His-Tag, Myc-Tag

Catalog Number: USB-585995
Article Name: Protein Mono-ADP-ribosyltransferase PARP14, Recombinant, Human, aa1605-1801, His-Tag, Myc-Tag
Biozol Catalog Number: USB-585995
Supplier Catalog Number: 585995
Alternative Catalog Number: USB-585995-20, USB-585995-100
Manufacturer: US Biological
Category: Molekularbiologie
ADP-ribosyltransferase that mediates mono-ADP-ribosylation of glutamate residues on target proteins. In contrast to PARP1 and PARP2, it is not able to mediate poly-ADP-ribosylation. Has been shown to catalyze the mono-ADP-ribosylation of STAT1 at Glu-657 and Glu-705, thus decreasing STAT1 phosphorylation which negatively regulates pro-inflammatory cytokine production in macrophages in response to IFNG stimulation. However, the role of ADP-ribosylation in the prevention of STAT1 phosphorylation has been called into question and it has been suggested that the inhibition of phosphorylation may be the result of sumoylation of STAT1 Lys-703. Mono-ADP-ribosylates STAT6, enhancing STAT6-dependent transcription. In macrophages, positively regulates MRC1 expression in response to IL4 stimulation by promoting STAT6 phosphorylation. Mono-ADP-ribosylates PARP9. Source: Recombinant protein corresponding to aa1605-1801 from human Protein mono-ADP-ribosyltransferase PARP14, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~30.0kD Amino Acid Sequence: IPAHWSDMKQQNFCVVELLPSDPEYNTVASKFNQTCSHFRIEKIERIQNPDLWNSYQAKKKTMDAKNGQTMNEKQLFHGTDAGSVPHVNRNGFNRSYAGKNAVAYGKGTYFAVNANYSANDTYSRPDANGRKHVYYVRVLTGIYTHGNHSLIVPPSKNPQNPTDLYDTVTDNVHHPSLFVAFYDYQAYPEYLITFRK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 30
UniProt: Q460N5
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.