Protein p34, Recombinant, Rickettsia Rickettsii, aa192-301, His-Tag, Myc-Tag

Product Overview

• Article Name: Protein p34, Recombinant, Rickettsia Rickettsii, aa192-301, His-Tag, Myc-Tag
• Biozol Catalog Number: USB-586002
• Supplier Catalog Number: 586002
• Alternative Catalog Number: USB-586002-20,USB-586002-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Recombinant protein corresponding to aa192-301 from Rickettsia rickettsii Protein p34 (strain Sheila Smith), fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~20.4kD Amino Acid Sequence: HSSYSLFKKAFKNLVDHELPEQDRQKIISIVNNHLGAKGMHEMKTRYAGQKAFIQCHLEMDGNMSLYNAHKISDEIAFEILQEFPEAEIIIHQDPFGIEEHVKYREYIVR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 20.4
• UniProt: P21559
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.