Protein PrgJ, Recombinant, Salmonella typhimurium, aa1-101, His-SUMOSTAR-Tag

Product Overview

• Article Name: Protein PrgJ, Recombinant, Salmonella typhimurium, aa1-101, His-SUMOSTAR-Tag
• Biozol Catalog Number: USB-586012
• Supplier Catalog Number: 586012
• Alternative Catalog Number: USB-586012-20,USB-586012-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Required for invasion of epithelial cells. Source: Recombinant protein corresponding to aa1-101 from Salmonella typhimurium Protein PrgJ, fused to 6X His-SUMOSTAR-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~26.9kD Amino Acid Sequence: MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 26.9
• UniProt: P41785
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.