Protein S100-A10, Recombinant, Human, aa1-97, His-Tag, Myc-Tag

Product Overview

• Article Name: Protein S100-A10, Recombinant, Human, aa1-97, His-Tag, Myc-Tag
• Biozol Catalog Number: USB-586014
• Supplier Catalog Number: 586014
• Alternative Catalog Number: USB-586014-20,USB-586014-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Because S100A10 induces the dimerization of ANXA2/p36, it may function as a regulator of protein phosphorylation in that the ANXA2 monomer is the preferred target (in vitro) of tyrosine-specific kinase. Source: Recombinant protein corresponding to aa1-97 from human Protein S100-A10, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~18.2kD Amino Acid Sequence: MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 18.2
• UniProt: P60903
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.