Protein S100-A14, Recombinant, Human, aa1-104, His-SUMOSTAR-Tag

Catalog Number: USB-586015
Article Name: Protein S100-A14, Recombinant, Human, aa1-104, His-SUMOSTAR-Tag
Biozol Catalog Number: USB-586015
Supplier Catalog Number: 586015
Alternative Catalog Number: USB-586015-20, USB-586015-100
Manufacturer: US Biological
Category: Molekularbiologie
Modulates P53/TP53 protein levels, and thereby plays a role in the regulation of cell survival and apoptosis. Depending on the context, it can promote cell proliferation or apoptosis. Plays a role in the regulation of cell migration by modulating the levels of MMP2, a matrix protease that is under transcriptional control of P53/TP53. Does not bind calcium. Source: Recombinant protein corresponding to aa1-104 from human Protein S100-A14, fused to 6X His-SUMOSTAR-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~27.kD Amino Acid Sequence: MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 27
UniProt: Q9HCY8
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.