Protein Wiz, Recombinant, Human, aa1228-1419, His-Myc-Tag

Product Overview

• Article Name: Protein Wiz, Recombinant, Human, aa1228-1419, His-Myc-Tag
• Biozol Catalog Number: USB-586025
• Supplier Catalog Number: 586025
• Alternative Catalog Number: USB-586025-20,USB-586025-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

May link EHMT1 and EHMT2 histone methyltransferases to the CTBP corepressor machinery. May be involved in EHMT1-EHMT2 heterodimer formation and stabilization. Source: Recombinant protein corresponding to aa1228-1419 from human Protein Wiz, fused to 6X His-Myc-Tag at C-terminal, expressed in Yeast. Molecular Weight: ~28.1kD Amino Acid Sequence: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFRTRCEFCGEFFENRKGLSSHARSHLRQMGVTEWSVNGSPIDTLREILKKKSKPCLIKKEPPAGDLAPALAEDGPPTVAPGPVQSPLPLSPLAGRPGKPGAGPAQVPRELSLTPITGAKPSATGYLGSVAAKRPLQEDRLLPAEVKAKTYIQTELPFKAKTLHEKTSHSSTEACCELCGLYFENRKALASHARAH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 28.1
• UniProt: O95785
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.