Protein Wnt-6, Recombinant, Mouse, aa24-364, His-SUMO-Tag

Product Overview

• Article Name: Protein Wnt-6, Recombinant, Mouse, aa24-364, His-SUMO-Tag
• Biozol Catalog Number: USB-586039
• Supplier Catalog Number: 586039
• Alternative Catalog Number: USB-586039-20,USB-586039-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters. Source: Recombinant protein corresponding to aa24-364 from mouse Protein Wnt-6, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~50.2kD Amino Acid Sequence: LWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPEVVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRVLQQDIRETAFVFAITAAGASHAVTQACSMGELLQCGCQAPRGRAPPRPSGLLGTPGPPGPTGSPDASAAWEWGGCGDDVDFGDEKSRLFMDAQHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKLPPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKELSLCL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 50.2
• UniProt: P22727
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.