Protein-lysine 6-oxidase, Recombinant, Mouse, aa163-411, His-Myc-Tag

Catalog Number: USB-586051
Article Name: Protein-lysine 6-oxidase, Recombinant, Mouse, aa163-411, His-Myc-Tag
Biozol Catalog Number: USB-586051
Supplier Catalog Number: 586051
Alternative Catalog Number: USB-586051-20,USB-586051-100
Manufacturer: US Biological
Category: Molekularbiologie
Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. Regulator of Ras expression. May play a role in tumor suppression. Plays a role in the aortic wall architecture. Source: Recombinant protein corresponding to aa163-411 from mouse Protein-lysine 6-oxidase, fused to 6X His-Myc-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~32.4kD Amino Acid Sequence: DDPYNPYKYSDDNPYYNYYDTYERPRPGSRNRPGYGTGYFQYGLPDLVPDPYYIQASTYVQKMSMYNLRCAAEENCLASSAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYAADIDCQWIDITDVQPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 32.4
UniProt: P28301
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.