Prothymosin Alpha, Recombinant, Human, aa1-111, His-Tag

Catalog Number: USB-586060
Article Name: Prothymosin Alpha, Recombinant, Human, aa1-111, His-Tag
Biozol Catalog Number: USB-586060
Supplier Catalog Number: 586060
Alternative Catalog Number: USB-586060-20, USB-586060-100
Manufacturer: US Biological
Category: Molekularbiologie
Prothymosin alpha may mediate immune function by conferring resistance to certain opportunistic infections. Full length recombinant protein corresponding to aa1-111 from human Prothymosin alpha, fused to 10X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~14.7kD Amino Acid Sequence: MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAENEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAESATGKRAAEDDEDDDVDTKKQKTDEDD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 14.7
UniProt: P06454
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.