Pulmonary Surfactant-associated Protein B, Recombinant, Bovine, aa23-187, His-Tag, Myc-Tag

Catalog Number: USB-586071
Article Name: Pulmonary Surfactant-associated Protein B, Recombinant, Bovine, aa23-187, His-Tag, Myc-Tag
Biozol Catalog Number: USB-586071
Supplier Catalog Number: 586071
Alternative Catalog Number: USB-586071-20, USB-586071-100
Manufacturer: US Biological
Category: Molekularbiologie
Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter. Source: Recombinant protein corresponding to aa23-187 from bovine Pulmonary surfactant-associated protein B, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~23.5kD Amino Acid Sequence: AAITYSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVEADDLCQECENISRLLTKMAKEAIFQDSVRKFLEQECDVLPLKLLAPLCRHLLDTYFPLIIEHFQSHMNPKFICQHVGLCKPRHPEPGKGPEPWGPLLDKLALPLLPGVPQAKPGPQTQDLSEQL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 23.5
UniProt: P15781
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.