Pulmonary Surfactant-associated Protein B, Recombinant, Human, aa201-279

Product Overview

• Article Name: Pulmonary Surfactant-associated Protein B, Recombinant, Human, aa201-279
• Biozol Catalog Number: USB-586072
• Supplier Catalog Number: 586072
• Alternative Catalog Number: USB-586072-20,USB-586072-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter. Recombinant protein corresponding to aa201-279 from human Pulmonary surfactant-associated protein B, expressed in Yeast. Molecular Weight: ~8.7kD Amino Acid Sequence: FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 8.7
• UniProt: P07988
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.