Pulmonary Surfactant-associated Protein C, Recombinant, Human, aa24-58, His-Tag

Product Overview

• Article Name: Pulmonary Surfactant-associated Protein C, Recombinant, Human, aa24-58, His-Tag
• Biozol Catalog Number: USB-586077
• Supplier Catalog Number: 586077
• Alternative Catalog Number: USB-586077-20, USB-586077-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. Recombinant protein corresponding to aa24-58 from human Pulmonary surfactant-associated protein C, fused to 6X His-Tag at N-terminal, expressed in Mammalian cell. Swiss/Uniprot: P11686 Molecular Weight: ~7.7kD Amino Acid Sequence: FGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 7.7
• UniProt: P11686
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.