Putative Monooxygenase ydhR, Recombinant, E. coli, aa1-101, His-Tag, Myc-Tag

Catalog Number: USB-586088
Article Name: Putative Monooxygenase ydhR, Recombinant, E. coli, aa1-101, His-Tag, Myc-Tag
Biozol Catalog Number: USB-586088
Supplier Catalog Number: 586088
Alternative Catalog Number: USB-586088-20,USB-586088-100
Manufacturer: US Biological
Category: Molekularbiologie
May function as monooxygenase and play a role in the metabolism of aromatic compounds. Source: Recombinant protein corresponding to aa1-101 from Escherichia coli Putative monooxygenase ydhR, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~18.3kD Amino Acid Sequence: MATLLQLHFAFNGPFGDAMAEQLKPLAESINQEPGFLWKVWTESEKNHEAGGIYLFTDEKSALAYLEKHTARLKNLGVEEVVAKVFDVNEPLSQINQAKLA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 18.3
UniProt: P0ACX3
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.