Relaxosome Protein TraY, Recombinant, E. coli, aa1-75, His-KSI-Tag

Product Overview

• Article Name: Relaxosome Protein TraY, Recombinant, E. coli, aa1-75, His-KSI-Tag
• Biozol Catalog Number: USB-586142
• Supplier Catalog Number: 586142
• Alternative Catalog Number: USB-586142-20, USB-586142-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Conjugative DNA transfer (CDT) is the unidirectional transfer of ssDNA plasmid from a donor to a recipient cell. It is the central mechanism by which antibiotic resistance and virulence factors are propagated in bacterial populations. Part of the relaxosome, which facilitates a site- and strand-specific cut in the origin of transfer by TraI, at the nic site. Relaxosome formation requires binding of IHF and TraY to the oriT region, which then facilitates binding of TraI. Also positively regulates tra gene expression. Source: Recombinant protein corresponding to aa1-75 from Escherichia coli Relaxosome protein TraY, fused to 6X His-KSI-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~24.4kD Amino Acid Sequence: EGEASEQLQCERELQELQERELKACQQVMDQQLRDISPECHPVVVSPVAGQYEQQIVVPPKGGSFYPGETTPPQQLQQRIFWGIPALLKRYYPSVTCPQQVSYYPGQASPQRPGQGQQPGQGQQGYYPTSPQQPGQWQQPEQGQPRYYPTSPQQSGQLQQPAQGQQPGQGQQG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 24.4
• UniProt: P10512
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.