Replication Factor C Subunit 1, Recombinant, Human, aa402-492, His-Tag, Myc-Tag

Product Overview

• Article Name: Replication Factor C Subunit 1, Recombinant, Human, aa402-492, His-Tag, Myc-Tag
• Biozol Catalog Number: USB-586149
• Supplier Catalog Number: 586149
• Alternative Catalog Number: USB-586149-20,USB-586149-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins PCNA and activator 1. This subunit binds to the primer-template junction. Binds the PO-B transcription element as well as other GA rich DNA sequences. Could play a role in DNA transcription regulation as well as DNA replication and/or repair. Can bind single- or double-stranded DNA. Partial recombinant protein corresponding to aa402-492 from human Replication factor C subunit 1, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~13.8kD Amino Acid Sequence: GAENCLEGLIFVITGVLESIERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKIIDEDGLLNLIRTMPGKKSKYEIA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 13.8
• UniProt: P35251
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.