Reproductive and Respiratory Syndrome Virus Nucleocapsid Protein, Recombinant, Porcine, aa1-123

Product Overview

• Article Name: Reproductive and Respiratory Syndrome Virus Nucleocapsid Protein, Recombinant, Porcine, aa1-123
• Biozol Catalog Number: USB-586154
• Supplier Catalog Number: 586154
• Alternative Catalog Number: USB-586154-20,USB-586154-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Full length recombinant protein corresponding to aa1-123 from porcine Reproductive and respiratory syndrome virus Nucleocapsid protein, expressed in E.coli. Molecular Weight: ~13.6kD Amino Acid Sequence: MPNNNGKQQKRKKGDGQPVNQLCQMLGKIITQQNQSRGKGPGKKNKKKNPEKPHFPLATEDDVRHHFTPSERQLCLSSIQTAFNQGAGTCTLSDSGRISYTVEFSLPTHHTVRLIRVTASPSA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 13.6
• UniProt: V5N6H2
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.