Retinoic Acid-induced Protein 3, Recombinant, Human, aa269-357, GST-Tag
Biozol Catalog Number:
USB-586159
Supplier Catalog Number:
586159
Alternative Catalog Number:
USB-586159-20,USB-586159-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Orphan receptor. Could be involved in modulating differentiation and maintaining homeostasis of epithelial cells. This retinoic acid-inducible GPCR provide evidence for a possible interaction between retinoid and G-protein signaling pathways. Functions as a negative modulator of EGFR signaling. May act as a lung tumor suppressor. Source: Recombinant protein corresponding to aa269-357 from human Retinoic acid-induced protein 3, fused to GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~37.0kD Amino Acid Sequence: TKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDYEVKKEGS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted