Rho-related GTP-binding Protein RhoG, Recombinant, Human, aa1-188, His-Tag, Myc-Tag

Product Overview

• Article Name: Rho-related GTP-binding Protein RhoG, Recombinant, Human, aa1-188, His-Tag, Myc-Tag
• Biozol Catalog Number: USB-586165
• Supplier Catalog Number: 586165
• Alternative Catalog Number: USB-586165-20,USB-586165-100,USB-586165-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Required for the formation of membrane ruffles during macropinocytosis. Plays a role in cell migration and is required for the formation of cup-like structures during trans-endothelial migration of leukocytes. In case of Salmonella enterica infection, activated by SopB and ARHGEF26/SGEF, which induces cytoskeleton rearrangements and promotes bacterial entry. Source: Recombinant protein corresponding to aa1-188 from human Rho-related GTP-binding protein RhoG, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~28.4kD Amino Acid Sequence: MQSIKCVVVGDGAVGKTCLLICYTTNAFPKEYIPTVFDNYSAQSAVDGRTVNLNLWDTAGQEEYDRLRTLSYPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPTPIKRGRSC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 28.4
• UniProt: P84095
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.