Ribonuclease 4, Recombinant, Human, aa29-147, MBP-Tag, His-Tag

Catalog Number: USB-586176
Article Name: Ribonuclease 4, Recombinant, Human, aa29-147, MBP-Tag, His-Tag
Biozol Catalog Number: USB-586176
Supplier Catalog Number: 586176
Alternative Catalog Number: USB-586176-20,USB-586176-100
Manufacturer: US Biological
Category: Molekularbiologie
This RNase has marked specificity towards the 3 side of uridine nucleotides. Source: Recombinant protein corresponding to aa29-147 from human Ribonuclease 4, fused to MBP-Tag at N-terminal and 6X His-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~57.8kD Amino Acid Sequence: QDGMYQRFLRQHVHPEETGGSDRYCNLMMQRRKMTLYHCKRFNTFIHEDIWNIRSICSTTNIQCKNGKMNCHEGVVKVTDCRDTGSSRAPNCRYRAIASTRRVVIACEGNPQVPVHFDG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 57.8
UniProt: P34096
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.