RibonucleaseAlpha-sarcin, Recombinant, Aspergillus giganteus, aa28-177, His-Tag, Myc-Tag

Catalog Number: USB-586186
Article Name: RibonucleaseAlpha-sarcin, Recombinant, Aspergillus giganteus, aa28-177, His-Tag, Myc-Tag
Biozol Catalog Number: USB-586186
Supplier Catalog Number: 586186
Alternative Catalog Number: USB-586186-20,USB-586186-100
Manufacturer: US Biological
Category: Molekularbiologie
Alpha-sarcin is specific for purines in both single- and double-stranded RNA. Its toxic action on eukaryotic cells is the result of cleavage of a single phosphodiester bond in the 60S subunit of ribosomes. Inhibits both the EFl (elongation factor 1)-dependent binding of aminoacyl-tRNA and the GTP-dependent binding of EF2 (elongation factor 2) to ribosomes. Source: Recombinant protein corresponding to aa28-177 from Aspergillus giganteus Ribonuclease alpha-sarcin, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~25.2kD Amino Acid Sequence: AVTWTCLNDQKNPKTNKYETKRLLYNQNKAESNSHHAPLSDGKTGSSYPHWFTNGYDGDGKLPKGRTPIKFGKSDCDRPPKHSKDGNGKTDHYLLEFPTFPDGHDYKFDSKKPKENPGPARVIYTYPNKVFCGIIAHTKENQGELKLCSH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 25.2
UniProt: P00655
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.