Ribosome-inactivating Protein Karasurin-C, Recombinant, Trichosanthes kirilowii, aa22-270, His-Tag

Product Overview

• Article Name: Ribosome-inactivating Protein Karasurin-C, Recombinant, Trichosanthes kirilowii, aa22-270, His-Tag
• Biozol Catalog Number: USB-586192
• Supplier Catalog Number: 586192
• Alternative Catalog Number: USB-586192-20,USB-586192-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Abortion-inducing protein. It inactivates eukaryotic 60S ribosomal subunits. Source: Recombinant protein corresponding to aa22-270 from Trichosanthes kirilowii Ribosome-inactivating protein karasurin-C, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~29.4kD Amino Acid Sequence: EGDVSFRLSGATSSSYGVFISNLRKALPYERKLYDIPLLRSTLPGSQRYALIHLTNYADETISVAIDVTNVYVMGYRAGDTSYFFNEASATEAAKYVFKDAKRKVTLPYSGNYERLQIAAGKIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSALSKQIQIASTNNGQFETPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNNMA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 29.4
• UniProt: P24478
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.