Ribosome-inactivating Protein Lychnin, Recombinant, Silene chalcedonica, aa1-234, His-Tag

Product Overview

• Article Name: Ribosome-inactivating Protein Lychnin, Recombinant, Silene chalcedonica, aa1-234, His-Tag
• Biozol Catalog Number: USB-586193
• Supplier Catalog Number: 586193
• Alternative Catalog Number: USB-586193-20,USB-586193-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Ribosome-inactivating protein of type 1, inhibits protein synthesis in animal cells. Inhibits cell-free translation in rabbit reticulocyte lysate system with an IC(50) of 0.17nM. Source: Recombinant protein corresponding to aa1-234 from Silene chalcedonica Ribosome-inactivating protein lychnin, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~30.1kD Amino Acid Sequence: RPSWTVDSDSAKYSSFLDSLREEFGRGTPKVCNIPVTKKANNDKFVLVNLVLPFNRNTITLAFRASDAYLVGFQDRDSKTNKLRANFFSDEYRALSGKYKSIFTDAEVLAPALPCASTYTDLQNKAGVSREKLSLGVSSLQTAFTAVYGKVFTGKNVAKFALISIQMVAEAARFKYIEDQVINRGMYSSFEAGARITLLENNWSKISEQYHKSCKLGGGQFTEEEMKLGLLLYN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 30.1
• UniProt: P85101
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.